Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,440
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 10,352
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 10,324
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,298
  5. Avatar for Go Science 5. Go Science 22 pts. 10,172
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,115
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,109
  8. Avatar for Contenders 8. Contenders 5 pts. 9,982
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,743
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 2 pts. 8,794
  1. Avatar for Fowardint 121. Fowardint Lv 1 1 pt. 7,546
  2. Avatar for peng.yang.1 122. peng.yang.1 Lv 1 1 pt. 7,545
  3. Avatar for Dr.Otterpop 123. Dr.Otterpop Lv 1 1 pt. 7,543
  4. Avatar for icaru-5 124. icaru-5 Lv 1 1 pt. 7,525
  5. Avatar for gask09 125. gask09 Lv 1 1 pt. 7,444
  6. Avatar for picollo 126. picollo Lv 1 1 pt. 7,442
  7. Avatar for rswiech 127. rswiech Lv 1 1 pt. 7,441
  8. Avatar for Zedes 128. Zedes Lv 1 1 pt. 7,424
  9. Avatar for Mike Cassidy 129. Mike Cassidy Lv 1 1 pt. 7,357
  10. Avatar for genegene 130. genegene Lv 1 1 pt. 7,329

Comments