Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,440
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 10,352
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 10,324
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,298
  5. Avatar for Go Science 5. Go Science 22 pts. 10,172
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,115
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,109
  8. Avatar for Contenders 8. Contenders 5 pts. 9,982
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,743
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 2 pts. 8,794
  1. Avatar for rezaefar 81. rezaefar Lv 1 2 pts. 8,764
  2. Avatar for vakobo 82. vakobo Lv 1 2 pts. 8,763
  3. Avatar for Wipf 83. Wipf Lv 1 2 pts. 8,760
  4. Avatar for rabamino12358 84. rabamino12358 Lv 1 2 pts. 8,729
  5. Avatar for gldisater 85. gldisater Lv 1 1 pt. 8,711
  6. Avatar for alyssa_d 86. alyssa_d Lv 1 1 pt. 8,709
  7. Avatar for fisherlr777 87. fisherlr777 Lv 1 1 pt. 8,690
  8. Avatar for Thebatman012 88. Thebatman012 Lv 1 1 pt. 8,664
  9. Avatar for JasperD 89. JasperD Lv 1 1 pt. 8,652
  10. Avatar for YeshuaLives 90. YeshuaLives Lv 1 1 pt. 8,638

Comments