Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,440
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 10,352
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 10,324
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,298
  5. Avatar for Go Science 5. Go Science 22 pts. 10,172
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,115
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,109
  8. Avatar for Contenders 8. Contenders 5 pts. 9,982
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,743
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 2 pts. 8,794
  1. Avatar for nicobul 21. nicobul Lv 1 46 pts. 9,997
  2. Avatar for Museka 22. Museka Lv 1 44 pts. 9,994
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 42 pts. 9,982
  4. Avatar for Bruno Kestemont 24. Bruno Kestemont Lv 1 41 pts. 9,966
  5. Avatar for drumpeter18yrs9yrs 25. drumpeter18yrs9yrs Lv 1 39 pts. 9,953
  6. Avatar for crpainter 26. crpainter Lv 1 37 pts. 9,952
  7. Avatar for smilingone 27. smilingone Lv 1 36 pts. 9,947
  8. Avatar for robgee 28. robgee Lv 1 34 pts. 9,910
  9. Avatar for Deleted player 29. Deleted player pts. 9,905
  10. Avatar for Marvelz 30. Marvelz Lv 1 31 pts. 9,904

Comments