Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,440
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 10,352
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 10,324
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,298
  5. Avatar for Go Science 5. Go Science 22 pts. 10,172
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,115
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,109
  8. Avatar for Contenders 8. Contenders 5 pts. 9,982
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,743
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 2 pts. 8,794
  1. Avatar for Norrjane 41. Norrjane Lv 1 19 pts. 9,719
  2. Avatar for diamonddays 42. diamonddays Lv 1 18 pts. 9,708
  3. Avatar for hansvandenhof 43. hansvandenhof Lv 1 17 pts. 9,703
  4. Avatar for Vinara 44. Vinara Lv 1 16 pts. 9,695
  5. Avatar for drjr 45. drjr Lv 1 15 pts. 9,694
  6. Avatar for phi16 46. phi16 Lv 1 14 pts. 9,687
  7. Avatar for fpc 47. fpc Lv 1 14 pts. 9,671
  8. Avatar for tarimo 48. tarimo Lv 1 13 pts. 9,661
  9. Avatar for Anfinsen_slept_here 49. Anfinsen_slept_here Lv 1 12 pts. 9,659
  10. Avatar for TastyMunchies 50. TastyMunchies Lv 1 12 pts. 9,645

Comments