Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,440
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 10,352
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 10,324
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,298
  5. Avatar for Go Science 5. Go Science 22 pts. 10,172
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,115
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,109
  8. Avatar for Contenders 8. Contenders 5 pts. 9,982
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,743
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 2 pts. 8,794
  1. Avatar for georg137 31. georg137 Lv 1 30 pts. 9,903
  2. Avatar for stomjoh 32. stomjoh Lv 1 29 pts. 9,898
  3. Avatar for dcrwheeler 33. dcrwheeler Lv 1 27 pts. 9,889
  4. Avatar for silent gene 34. silent gene Lv 1 26 pts. 9,887
  5. Avatar for jausmh 35. jausmh Lv 1 25 pts. 9,829
  6. Avatar for Maerlyn138 36. Maerlyn138 Lv 1 24 pts. 9,796
  7. Avatar for Idiotboy 37. Idiotboy Lv 1 23 pts. 9,778
  8. Avatar for Flagg65a 38. Flagg65a Lv 1 21 pts. 9,767
  9. Avatar for isaksson 39. isaksson Lv 1 20 pts. 9,756
  10. Avatar for O Seki To 40. O Seki To Lv 1 20 pts. 9,743

Comments