Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,886
  2. Avatar for Go Science 2. Go Science 71 pts. 9,787
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,765
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,741
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,739
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,696
  7. Avatar for Contenders 7. Contenders 8 pts. 9,675
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,603
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,428
  10. Avatar for Russian team 10. Russian team 2 pts. 9,288
  1. Avatar for grogar7 141. grogar7 Lv 1 1 pt. 3,378
  2. Avatar for Hollinas 142. Hollinas Lv 1 1 pt. 3,378
  3. Avatar for LociOilingIRC 143. LociOilingIRC Lv 1 1 pt. 3,378
  4. Avatar for bkoep 144. bkoep Lv 1 1 pt. 3,378
  5. Avatar for Sydefecks 145. Sydefecks Lv 1 1 pt. 3,378
  6. Avatar for kw48152 146. kw48152 Lv 1 1 pt. 3,378
  7. Avatar for ananya.b 147. ananya.b Lv 1 1 pt. 3,378
  8. Avatar for spvincent 148. spvincent Lv 1 1 pt. 3,378
  9. Avatar for Ricardo Oliveira 149. Ricardo Oliveira Lv 1 1 pt. 3,378

Comments