Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,689
  2. Avatar for freefolder 12. freefolder 1 pt. 8,542
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,191
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,312
  5. Avatar for Window Group 15. Window Group 1 pt. 6,446
  6. Avatar for SRHS AP Biology 16. SRHS AP Biology 1 pt. 3,378

  1. Avatar for momadoc 121. momadoc Lv 1 1 pt. 7,437
  2. Avatar for TurtleWomen 122. TurtleWomen Lv 1 1 pt. 7,379
  3. Avatar for orily1337 123. orily1337 Lv 1 1 pt. 7,375
  4. Avatar for drjr 124. drjr Lv 1 1 pt. 7,349
  5. Avatar for doctaven 125. doctaven Lv 1 1 pt. 7,312
  6. Avatar for Liuyuanchen 126. Liuyuanchen Lv 1 1 pt. 7,296
  7. Avatar for DannyBoy77 127. DannyBoy77 Lv 1 1 pt. 7,186
  8. Avatar for altejoh 128. altejoh Lv 1 1 pt. 7,179
  9. Avatar for PregnantPickle 129. PregnantPickle Lv 1 1 pt. 6,985
  10. Avatar for gdnskye 130. gdnskye Lv 1 1 pt. 6,846

Comments