Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,886
  2. Avatar for Go Science 2. Go Science 71 pts. 9,787
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,765
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,741
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,739
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,696
  7. Avatar for Contenders 7. Contenders 8 pts. 9,675
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,603
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,428
  10. Avatar for Russian team 10. Russian team 2 pts. 9,288

  1. Avatar for momadoc 121. momadoc Lv 1 1 pt. 7,437
  2. Avatar for TurtleWomen 122. TurtleWomen Lv 1 1 pt. 7,379
  3. Avatar for orily1337 123. orily1337 Lv 1 1 pt. 7,375
  4. Avatar for drjr 124. drjr Lv 1 1 pt. 7,349
  5. Avatar for doctaven 125. doctaven Lv 1 1 pt. 7,312
  6. Avatar for Liuyuanchen 126. Liuyuanchen Lv 1 1 pt. 7,296
  7. Avatar for DannyBoy77 127. DannyBoy77 Lv 1 1 pt. 7,186
  8. Avatar for altejoh 128. altejoh Lv 1 1 pt. 7,179
  9. Avatar for PregnantPickle 129. PregnantPickle Lv 1 1 pt. 6,985
  10. Avatar for gdnskye 130. gdnskye Lv 1 1 pt. 6,846

Comments