Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,689
  2. Avatar for freefolder 12. freefolder 1 pt. 8,542
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,191
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,312
  5. Avatar for Window Group 15. Window Group 1 pt. 6,446
  6. Avatar for SRHS AP Biology 16. SRHS AP Biology 1 pt. 3,378
  1. Avatar for roelria 141. roelria Lv 1 1 pt. 3,378
  2. Avatar for LociOilingIRC 142. LociOilingIRC Lv 1 1 pt. 3,378
  3. Avatar for bkoep 143. bkoep Lv 1 1 pt. 3,378
  4. Avatar for Sydefecks 144. Sydefecks Lv 1 1 pt. 3,378
  5. Avatar for JuliaAshley 145. JuliaAshley Lv 1 1 pt. 3,378
  6. Avatar for kw48152 146. kw48152 Lv 1 1 pt. 3,378
  7. Avatar for ananya.b 147. ananya.b Lv 1 1 pt. 3,378
  8. Avatar for spvincent 148. spvincent Lv 1 1 pt. 3,378
  9. Avatar for Ricardo Oliveira 149. Ricardo Oliveira Lv 1 1 pt. 3,378

Comments