Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,689
  2. Avatar for freefolder 12. freefolder 1 pt. 8,542
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,191
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,312
  5. Avatar for Window Group 15. Window Group 1 pt. 6,446
  6. Avatar for SRHS AP Biology 16. SRHS AP Biology 1 pt. 3,378

  1. Avatar for Flagg65a 62. Flagg65a Lv 1 8 pts. 8,949
  2. Avatar for ManVsYard 63. ManVsYard Lv 1 7 pts. 8,920
  3. Avatar for dbuske 64. dbuske Lv 1 7 pts. 8,885
  4. Avatar for toshiue 65. toshiue Lv 1 6 pts. 8,866
  5. Avatar for Crossed Sticks 66. Crossed Sticks Lv 1 6 pts. 8,742
  6. Avatar for fisherlr777 67. fisherlr777 Lv 1 6 pts. 8,706
  7. Avatar for versat82 68. versat82 Lv 1 5 pts. 8,689
  8. Avatar for Squirrely 69. Squirrely Lv 1 5 pts. 8,670
  9. Avatar for pfirth 70. pfirth Lv 1 5 pts. 8,667

Comments