Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,886
  2. Avatar for Go Science 2. Go Science 71 pts. 9,787
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,765
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,741
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,739
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,696
  7. Avatar for Contenders 7. Contenders 8 pts. 9,675
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,603
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,428
  10. Avatar for Russian team 10. Russian team 2 pts. 9,288
  1. Avatar for Anfinsen_slept_here 61. Anfinsen_slept_here Lv 1 8 pts. 8,959
  2. Avatar for Flagg65a 62. Flagg65a Lv 1 8 pts. 8,949
  3. Avatar for ManVsYard 63. ManVsYard Lv 1 7 pts. 8,920
  4. Avatar for dbuske 64. dbuske Lv 1 7 pts. 8,885
  5. Avatar for toshiue 65. toshiue Lv 1 6 pts. 8,866
  6. Avatar for Crossed Sticks 66. Crossed Sticks Lv 1 6 pts. 8,742
  7. Avatar for fisherlr777 67. fisherlr777 Lv 1 6 pts. 8,706
  8. Avatar for versat82 68. versat82 Lv 1 5 pts. 8,689
  9. Avatar for Squirrely 69. Squirrely Lv 1 5 pts. 8,670
  10. Avatar for pfirth 70. pfirth Lv 1 5 pts. 8,667

Comments