Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404
  1. Avatar for alyssa_d 101. alyssa_d Lv 1 1 pt. 8,404
  2. Avatar for gurch 102. gurch Lv 1 1 pt. 8,369
  3. Avatar for foldability 103. foldability Lv 1 1 pt. 8,366
  4. Avatar for 64133988 104. 64133988 Lv 1 1 pt. 8,322
  5. Avatar for oaks 105. oaks Lv 1 1 pt. 8,260
  6. Avatar for andrewxc 106. andrewxc Lv 1 1 pt. 8,223
  7. Avatar for NotJim99 107. NotJim99 Lv 1 1 pt. 8,221
  8. Avatar for Sydefecks 108. Sydefecks Lv 1 1 pt. 8,199
  9. Avatar for alexcole 109. alexcole Lv 1 1 pt. 8,194
  10. Avatar for kludbrook 110. kludbrook Lv 1 1 pt. 8,157

Comments