Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404
  1. Avatar for fage17 111. fage17 Lv 1 1 pt. 8,112
  2. Avatar for multaq 112. multaq Lv 1 1 pt. 8,107
  3. Avatar for GUANINJIN 113. GUANINJIN Lv 1 1 pt. 8,043
  4. Avatar for paulcianci 114. paulcianci Lv 1 1 pt. 7,918
  5. Avatar for AHOWARD5 115. AHOWARD5 Lv 1 1 pt. 7,883
  6. Avatar for icaru-5 116. icaru-5 Lv 1 1 pt. 7,858
  7. Avatar for tjonesster 117. tjonesster Lv 1 1 pt. 7,830
  8. Avatar for CureForEntropy 118. CureForEntropy Lv 1 1 pt. 7,772
  9. Avatar for orily1337 119. orily1337 Lv 1 1 pt. 7,703
  10. Avatar for emtonsti 120. emtonsti Lv 1 1 pt. 7,576

Comments