Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404
  1. Avatar for justjustin 121. justjustin Lv 1 1 pt. 7,211
  2. Avatar for somebody_else 122. somebody_else Lv 1 1 pt. 7,145
  3. Avatar for makin2018 123. makin2018 Lv 1 1 pt. 7,128
  4. Avatar for 01010011111 124. 01010011111 Lv 1 1 pt. 5,596
  5. Avatar for s2siscuh 125. s2siscuh Lv 1 1 pt. 4,300
  6. Avatar for jeromeroy 126. jeromeroy Lv 1 1 pt. 4,300
  7. Avatar for rnaprediction 127. rnaprediction Lv 1 1 pt. 4,300
  8. Avatar for ther9700 128. ther9700 Lv 1 1 pt. 4,300
  9. Avatar for Reuben_Allen 129. Reuben_Allen Lv 1 1 pt. 4,300
  10. Avatar for ALEXRKYR 130. ALEXRKYR Lv 1 1 pt. 4,300

Comments