Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404
  1. Avatar for tyler0911 11. tyler0911 Lv 1 69 pts. 9,699
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 67 pts. 9,679
  3. Avatar for frood66 13. frood66 Lv 1 64 pts. 9,668
  4. Avatar for Deleted player 14. Deleted player pts. 9,635
  5. Avatar for YeshuaLives 15. YeshuaLives Lv 1 59 pts. 9,631
  6. Avatar for crpainter 16. crpainter Lv 1 57 pts. 9,622
  7. Avatar for fpc 17. fpc Lv 1 55 pts. 9,616
  8. Avatar for phi16 18. phi16 Lv 1 52 pts. 9,616
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 50 pts. 9,596
  10. Avatar for robgee 20. robgee Lv 1 48 pts. 9,595

Comments