Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404
  1. Avatar for TastyMunchies 51. TastyMunchies Lv 1 11 pts. 9,248
  2. Avatar for Idiotboy 52. Idiotboy Lv 1 10 pts. 9,241
  3. Avatar for dcrwheeler 53. dcrwheeler Lv 1 10 pts. 9,240
  4. Avatar for Jesse Pinkman 54. Jesse Pinkman Lv 1 9 pts. 9,227
  5. Avatar for heather-1 55. heather-1 Lv 1 9 pts. 9,175
  6. Avatar for Vincera 56. Vincera Lv 1 8 pts. 9,160
  7. Avatar for toshiue 57. toshiue Lv 1 8 pts. 9,151
  8. Avatar for ClassicShyGuy 58. ClassicShyGuy Lv 1 7 pts. 9,132
  9. Avatar for DoctorSockrates 59. DoctorSockrates Lv 1 7 pts. 9,091
  10. Avatar for vakobo 60. vakobo Lv 1 7 pts. 9,070

Comments