Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404
  1. Avatar for georged 71. georged Lv 1 3 pts. 8,937
  2. Avatar for altejoh 72. altejoh Lv 1 3 pts. 8,893
  3. Avatar for Wojcimierz 73. Wojcimierz Lv 1 3 pts. 8,890
  4. Avatar for Sigonith 74. Sigonith Lv 1 3 pts. 8,888
  5. Avatar for pfirth 75. pfirth Lv 1 3 pts. 8,885
  6. Avatar for dpmattingly 76. dpmattingly Lv 1 2 pts. 8,872
  7. Avatar for rinze 77. rinze Lv 1 2 pts. 8,862
  8. Avatar for alcor29 78. alcor29 Lv 1 2 pts. 8,846
  9. Avatar for Altercomp 79. Altercomp Lv 1 2 pts. 8,837
  10. Avatar for ManVsYard 80. ManVsYard Lv 1 2 pts. 8,821

Comments