Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,902
  2. Avatar for Contenders 2. Contenders 70 pts. 9,833
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,803
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,780
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 9,777
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 9,769
  7. Avatar for Go Science 7. Go Science 7 pts. 9,687
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,668
  9. Avatar for Deleted group 9. Deleted group pts. 9,588
  10. Avatar for HMT heritage 10. HMT heritage 1 pt. 9,393
  1. Avatar for Buffalo-Phil 91. Buffalo-Phil Lv 1 1 pt. 8,552
  2. Avatar for Squirrely 92. Squirrely Lv 1 1 pt. 8,532
  3. Avatar for lamoille 93. lamoille Lv 1 1 pt. 8,518
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 1 pt. 8,512
  5. Avatar for micheldeweerd 95. micheldeweerd Lv 1 1 pt. 8,493
  6. Avatar for tarimo 96. tarimo Lv 1 1 pt. 8,478
  7. Avatar for Amphimixus 97. Amphimixus Lv 1 1 pt. 8,452
  8. Avatar for antibot215 98. antibot215 Lv 1 1 pt. 8,429
  9. Avatar for PlagueRat 99. PlagueRat Lv 1 1 pt. 8,415
  10. Avatar for Mao Mao 100. Mao Mao Lv 1 1 pt. 8,408

Comments