Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,902
  2. Avatar for Contenders 2. Contenders 70 pts. 9,833
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,803
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,780
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 9,777
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 9,769
  7. Avatar for Go Science 7. Go Science 7 pts. 9,687
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,668
  9. Avatar for Deleted group 9. Deleted group pts. 9,588
  10. Avatar for HMT heritage 10. HMT heritage 1 pt. 9,393
  1. Avatar for ViJay7019 61. ViJay7019 Lv 1 6 pts. 9,031
  2. Avatar for alwen 62. alwen Lv 1 6 pts. 9,018
  3. Avatar for Hellcat6 63. Hellcat6 Lv 1 6 pts. 9,015
  4. Avatar for Deleted player 64. Deleted player pts. 9,004
  5. Avatar for cbwest 65. cbwest Lv 1 5 pts. 8,978
  6. Avatar for Psych0Active 66. Psych0Active Lv 1 5 pts. 8,973
  7. Avatar for cobaltteal 67. cobaltteal Lv 1 4 pts. 8,960
  8. Avatar for Knoblerine 68. Knoblerine Lv 1 4 pts. 8,957
  9. Avatar for RyeSnake 69. RyeSnake Lv 1 4 pts. 8,957
  10. Avatar for Deleted player 70. Deleted player pts. 8,954

Comments