Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,311
  2. Avatar for Contenders 2. Contenders 78 pts. 11,044
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 11,022
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,992
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,854
  6. Avatar for Go Science 6. Go Science 24 pts. 10,812
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,708
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 10,668
  9. Avatar for Russian team 9. Russian team 8 pts. 10,153
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,520

  1. Avatar for Vincera 91. Vincera Lv 1 2 pts. 8,438
  2. Avatar for micheldeweerd 92. micheldeweerd Lv 1 2 pts. 8,415
  3. Avatar for aspadistra 93. aspadistra Lv 1 1 pt. 8,344
  4. Avatar for Kevonni 94. Kevonni Lv 1 1 pt. 8,294
  5. Avatar for Arne Heessels 95. Arne Heessels Lv 1 1 pt. 8,285
  6. Avatar for oaks 96. oaks Lv 1 1 pt. 8,251
  7. Avatar for pielie 97. pielie Lv 1 1 pt. 8,233
  8. Avatar for lconor 98. lconor Lv 1 1 pt. 8,165
  9. Avatar for j.wmprcht 99. j.wmprcht Lv 1 1 pt. 8,163
  10. Avatar for anthion 100. anthion Lv 1 1 pt. 8,138

Comments