Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,828
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,419
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 5,664
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 4,490
  5. Avatar for incognito group 15. incognito group 1 pt. 0

  1. Avatar for Hollinas 131. Hollinas Lv 1 1 pt. 0
  2. Avatar for ingoneato 133. ingoneato Lv 1 1 pt. 0
  3. Avatar for marvin24 134. marvin24 Lv 1 1 pt. 0
  4. Avatar for Idiotboy 135. Idiotboy Lv 1 1 pt. 0
  5. Avatar for syoifczeri 136. syoifczeri Lv 1 1 pt. 0

Comments