Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 4 pts. 9,548
  2. Avatar for Hold My Beer 12. Hold My Beer 3 pts. 9,137
  3. Avatar for Kotocycle 13. Kotocycle 2 pts. 9,039
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,676
  5. Avatar for BCC 15. BCC 1 pt. 8,622
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 8,617
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,508
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 8,291
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,283
  10. Avatar for freefolder 20. freefolder 1 pt. 8,231
  1. Avatar for vizhu2018 121. vizhu2018 Lv 1 1 pt. 8,396
  2. Avatar for jdmclure 122. jdmclure Lv 1 1 pt. 8,392
  3. Avatar for TheGUmmer 123. TheGUmmer Lv 1 1 pt. 8,374
  4. Avatar for micheldeweerd 124. micheldeweerd Lv 1 1 pt. 8,352
  5. Avatar for Savas 125. Savas Lv 1 1 pt. 8,291
  6. Avatar for mrfu 126. mrfu Lv 1 1 pt. 8,283
  7. Avatar for martinf 127. martinf Lv 1 1 pt. 8,279
  8. Avatar for tela 128. tela Lv 1 1 pt. 8,267
  9. Avatar for memam2018 129. memam2018 Lv 1 1 pt. 8,247
  10. Avatar for yavij2019 130. yavij2019 Lv 1 1 pt. 8,231

Comments