Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 10,445
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,344
  3. Avatar for Deleted group 13. Deleted group pts. 9,224
  4. Avatar for Dutch Power Cows 14. Dutch Power Cows 1 pt. 9,088
  5. Avatar for freefolder 15. freefolder 1 pt. 8,896
  6. Avatar for DW 2020 16. DW 2020 1 pt. 8,572
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 8,264
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 6,869
  9. Avatar for Kotocycle 19. Kotocycle 1 pt. 6,829

  1. Avatar for petetrig 111. petetrig Lv 1 1 pt. 8,299
  2. Avatar for Bletchley Park 112. Bletchley Park Lv 1 1 pt. 8,278
  3. Avatar for FrankytheBrain 113. FrankytheBrain Lv 1 1 pt. 8,264
  4. Avatar for Jesse Pinkman 114. Jesse Pinkman Lv 1 1 pt. 8,261
  5. Avatar for ourtown 115. ourtown Lv 1 1 pt. 8,256
  6. Avatar for Marvelz 116. Marvelz Lv 1 1 pt. 8,247
  7. Avatar for Lyshi2018 117. Lyshi2018 Lv 1 1 pt. 8,208
  8. Avatar for Cyberkashi 118. Cyberkashi Lv 1 1 pt. 8,055
  9. Avatar for molleke 119. molleke Lv 1 1 pt. 7,362
  10. Avatar for Knoblerine 120. Knoblerine Lv 1 1 pt. 7,321

Comments