Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 10,445
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,344
  3. Avatar for Deleted group 13. Deleted group pts. 9,224
  4. Avatar for Dutch Power Cows 14. Dutch Power Cows 1 pt. 9,088
  5. Avatar for freefolder 15. freefolder 1 pt. 8,896
  6. Avatar for DW 2020 16. DW 2020 1 pt. 8,572
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 8,264
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 6,869
  9. Avatar for Kotocycle 19. Kotocycle 1 pt. 6,829
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 0
  1. Avatar for SouperGenious 131. SouperGenious Lv 1 1 pt. 6,502
  2. Avatar for SiPot2018 132. SiPot2018 Lv 1 1 pt. 6,492
  3. Avatar for ugugu 133. ugugu Lv 1 1 pt. 6,334
  4. Avatar for borattt 134. borattt Lv 1 1 pt. 6,218
  5. Avatar for RootBeerSwordsman 135. RootBeerSwordsman Lv 1 1 pt. 6,014
  6. Avatar for 01010011111 136. 01010011111 Lv 1 1 pt. 5,829
  7. Avatar for kyoota 137. kyoota Lv 1 1 pt. 5,456
  8. Avatar for sydlg19 138. sydlg19 Lv 1 1 pt. 5,224
  9. Avatar for jdmclure 139. jdmclure Lv 1 1 pt. 5,193
  10. Avatar for Phyx 140. Phyx Lv 1 1 pt. 5,110

Comments