Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 10,445
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,344
  3. Avatar for Deleted group 13. Deleted group pts. 9,224
  4. Avatar for Dutch Power Cows 14. Dutch Power Cows 1 pt. 9,088
  5. Avatar for freefolder 15. freefolder 1 pt. 8,896
  6. Avatar for DW 2020 16. DW 2020 1 pt. 8,572
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 8,264
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 6,869
  9. Avatar for Kotocycle 19. Kotocycle 1 pt. 6,829
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 0
  1. Avatar for Hellcat6 61. Hellcat6 Lv 1 10 pts. 10,023
  2. Avatar for Bautho 62. Bautho Lv 1 9 pts. 9,974
  3. Avatar for spdenne 63. spdenne Lv 1 9 pts. 9,938
  4. Avatar for mitarcher 64. mitarcher Lv 1 9 pts. 9,883
  5. Avatar for jausmh 65. jausmh Lv 1 8 pts. 9,879
  6. Avatar for ViJay7019 66. ViJay7019 Lv 1 8 pts. 9,807
  7. Avatar for uihcv 67. uihcv Lv 1 7 pts. 9,803
  8. Avatar for KingLear 68. KingLear Lv 1 7 pts. 9,771
  9. Avatar for dnpw1 69. dnpw1 Lv 1 7 pts. 9,761
  10. Avatar for micheldeweerd 70. micheldeweerd Lv 1 6 pts. 9,732

Comments