Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 10,445
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,344
  3. Avatar for Deleted group 13. Deleted group pts. 9,224
  4. Avatar for Dutch Power Cows 14. Dutch Power Cows 1 pt. 9,088
  5. Avatar for freefolder 15. freefolder 1 pt. 8,896
  6. Avatar for DW 2020 16. DW 2020 1 pt. 8,572
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 8,264
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 6,869
  9. Avatar for Kotocycle 19. Kotocycle 1 pt. 6,829
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 0
  1. Avatar for Mortality 71. Mortality Lv 1 6 pts. 9,724
  2. Avatar for YeshuaLives 72. YeshuaLives Lv 1 6 pts. 9,688
  3. Avatar for rabamino12358 73. rabamino12358 Lv 1 5 pts. 9,678
  4. Avatar for TePie 74. TePie Lv 1 5 pts. 9,532
  5. Avatar for Vincera 75. Vincera Lv 1 5 pts. 9,520
  6. Avatar for Dhalion 76. Dhalion Lv 1 5 pts. 9,454
  7. Avatar for alcor29 77. alcor29 Lv 1 4 pts. 9,431
  8. Avatar for Rastamasta 78. Rastamasta Lv 1 4 pts. 9,406
  9. Avatar for fisherlr777 79. fisherlr777 Lv 1 4 pts. 9,403
  10. Avatar for Arne Heessels 80. Arne Heessels Lv 1 4 pts. 9,367

Comments