Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,529
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,205
  3. Avatar for freefolder 13. freefolder 1 pt. 9,166
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,981
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,723
  6. Avatar for Dutch Power Cows 16. Dutch Power Cows 1 pt. 8,501
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,481
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 8,469
  1. Avatar for spdenne 91. spdenne Lv 1 2 pts. 8,860
  2. Avatar for raptorchief42 92. raptorchief42 Lv 1 1 pt. 8,848
  3. Avatar for pauldunn 93. pauldunn Lv 1 1 pt. 8,841
  4. Avatar for frostschutz 94. frostschutz Lv 1 1 pt. 8,834
  5. Avatar for Znaika 95. Znaika Lv 1 1 pt. 8,823
  6. Avatar for rinze 96. rinze Lv 1 1 pt. 8,823
  7. Avatar for borattt 97. borattt Lv 1 1 pt. 8,815
  8. Avatar for Jesse Pinkman 98. Jesse Pinkman Lv 1 1 pt. 8,809
  9. Avatar for zid 99. zid Lv 1 1 pt. 8,796
  10. Avatar for fisherlr777 100. fisherlr777 Lv 1 1 pt. 8,774

Comments