Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,529
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,205
  3. Avatar for freefolder 13. freefolder 1 pt. 9,166
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,981
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,723
  6. Avatar for Dutch Power Cows 16. Dutch Power Cows 1 pt. 8,501
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,481
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 8,469
  1. Avatar for vakobo 101. vakobo Lv 1 1 pt. 8,770
  2. Avatar for martinf 102. martinf Lv 1 1 pt. 8,768
  3. Avatar for ViJay7019 103. ViJay7019 Lv 1 1 pt. 8,763
  4. Avatar for Singam 104. Singam Lv 1 1 pt. 8,750
  5. Avatar for lconor 105. lconor Lv 1 1 pt. 8,738
  6. Avatar for kludbrook 106. kludbrook Lv 1 1 pt. 8,732
  7. Avatar for alyssa_d 107. alyssa_d Lv 1 1 pt. 8,723
  8. Avatar for felixxy 108. felixxy Lv 1 1 pt. 8,717
  9. Avatar for micheldeweerd 109. micheldeweerd Lv 1 1 pt. 8,664
  10. Avatar for altejoh 110. altejoh Lv 1 1 pt. 8,662

Comments