Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,529
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,205
  3. Avatar for freefolder 13. freefolder 1 pt. 9,166
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,981
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,723
  6. Avatar for Dutch Power Cows 16. Dutch Power Cows 1 pt. 8,501
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,481
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 8,469

  1. Avatar for pandapharmd 112. pandapharmd Lv 1 1 pt. 8,592
  2. Avatar for Sunmurder 113. Sunmurder Lv 1 1 pt. 8,562
  3. Avatar for ugugu 114. ugugu Lv 1 1 pt. 8,526
  4. Avatar for Deleted player 115. Deleted player 1 pt. 8,514
  5. Avatar for mrfu 116. mrfu Lv 1 1 pt. 8,501
  6. Avatar for ourtown 117. ourtown Lv 1 1 pt. 8,494
  7. Avatar for Curiosity_the_cat 118. Curiosity_the_cat Lv 1 1 pt. 8,489
  8. Avatar for aspadistra 119. aspadistra Lv 1 1 pt. 8,481
  9. Avatar for FrankytheBrain 120. FrankytheBrain Lv 1 1 pt. 8,469

Comments