Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,529
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,205
  3. Avatar for freefolder 13. freefolder 1 pt. 9,166
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,981
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,723
  6. Avatar for Dutch Power Cows 16. Dutch Power Cows 1 pt. 8,501
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,481
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 8,469

  1. Avatar for Deleted player 121. Deleted player pts. 8,465
  2. Avatar for Knoblerine 122. Knoblerine Lv 1 1 pt. 8,460
  3. Avatar for roman madala 123. roman madala Lv 1 1 pt. 8,435
  4. Avatar for mirjamvandelft 124. mirjamvandelft Lv 1 1 pt. 8,416
  5. Avatar for KAOSkonfused 125. KAOSkonfused Lv 1 1 pt. 8,413
  6. Avatar for laurens1311 126. laurens1311 Lv 1 1 pt. 8,387
  7. Avatar for 01010011111 127. 01010011111 Lv 1 1 pt. 8,386
  8. Avatar for sydlg19 128. sydlg19 Lv 1 1 pt. 8,342
  9. Avatar for jung woo 129. jung woo Lv 1 1 pt. 8,303
  10. Avatar for Mateon1 130. Mateon1 Lv 1 1 pt. 8,289

Comments