Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,529
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,205
  3. Avatar for freefolder 13. freefolder 1 pt. 9,166
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,981
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,723
  6. Avatar for Dutch Power Cows 16. Dutch Power Cows 1 pt. 8,501
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,481
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 8,469
  1. Avatar for Atrus_Homeboy 131. Atrus_Homeboy Lv 1 1 pt. 8,203
  2. Avatar for zysiolo 132. zysiolo Lv 1 1 pt. 8,143
  3. Avatar for drumpeter18yrs9yrs 133. drumpeter18yrs9yrs Lv 1 1 pt. 8,129
  4. Avatar for komnor 134. komnor Lv 1 1 pt. 8,112
  5. Avatar for franse 135. franse Lv 1 1 pt. 8,084
  6. Avatar for momadoc 136. momadoc Lv 1 1 pt. 8,047
  7. Avatar for ZiZ 137. ZiZ Lv 1 1 pt. 8,030
  8. Avatar for mobythevan 138. mobythevan Lv 1 1 pt. 8,009
  9. Avatar for abiogenesis 139. abiogenesis Lv 1 1 pt. 8,004
  10. Avatar for GUANINJIN 140. GUANINJIN Lv 1 1 pt. 7,961

Comments