Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,529
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,205
  3. Avatar for freefolder 13. freefolder 1 pt. 9,166
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,981
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,723
  6. Avatar for Dutch Power Cows 16. Dutch Power Cows 1 pt. 8,501
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,481
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 8,469
  1. Avatar for xuzhengnjtech 141. xuzhengnjtech Lv 1 1 pt. 7,895
  2. Avatar for lamoille 142. lamoille Lv 1 1 pt. 7,880
  3. Avatar for ZeroPlusG 143. ZeroPlusG Lv 1 1 pt. 7,874
  4. Avatar for Belle36 144. Belle36 Lv 1 1 pt. 7,827
  5. Avatar for icaru-5 145. icaru-5 Lv 1 1 pt. 7,810
  6. Avatar for Misanthrope_177 146. Misanthrope_177 Lv 1 1 pt. 7,497
  7. Avatar for JCramer23gtq 147. JCramer23gtq Lv 1 1 pt. 7,457
  8. Avatar for Vincera 148. Vincera Lv 1 1 pt. 6,818
  9. Avatar for TePie 149. TePie Lv 1 1 pt. 4,200
  10. Avatar for orily1337 150. orily1337 Lv 1 1 pt. 3,869

Comments