Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,529
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,205
  3. Avatar for freefolder 13. freefolder 1 pt. 9,166
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,981
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,723
  6. Avatar for Dutch Power Cows 16. Dutch Power Cows 1 pt. 8,501
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,481
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 8,469
  1. Avatar for Deleted player 41. Deleted player 22 pts. 9,986
  2. Avatar for jobo0502 42. jobo0502 Lv 1 21 pts. 9,979
  3. Avatar for teraflop 43. teraflop Lv 1 20 pts. 9,967
  4. Avatar for diamonddays 44. diamonddays Lv 1 19 pts. 9,920
  5. Avatar for DoctorSockrates 45. DoctorSockrates Lv 1 18 pts. 9,896
  6. Avatar for Glen B 46. Glen B Lv 1 17 pts. 9,879
  7. Avatar for MicElephant 47. MicElephant Lv 1 17 pts. 9,852
  8. Avatar for Hellcat6 48. Hellcat6 Lv 1 16 pts. 9,825
  9. Avatar for tarimo 49. tarimo Lv 1 15 pts. 9,819
  10. Avatar for Norrjane 50. Norrjane Lv 1 14 pts. 9,815

Comments