Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,419
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,305
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,278
  4. Avatar for Contenders 4. Contenders 30 pts. 11,173
  5. Avatar for Go Science 5. Go Science 19 pts. 11,142
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,118
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 11,062
  8. Avatar for Russian team 8. Russian team 4 pts. 11,045
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,022
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,952
  1. Avatar for Museka 31. Museka Lv 1 34 pts. 10,982
  2. Avatar for NinjaGreg 32. NinjaGreg Lv 1 33 pts. 10,965
  3. Avatar for Steven Pletsch 33. Steven Pletsch Lv 1 31 pts. 10,952
  4. Avatar for guineapig 34. guineapig Lv 1 30 pts. 10,934
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 29 pts. 10,933
  6. Avatar for BrKapr 36. BrKapr Lv 1 28 pts. 10,932
  7. Avatar for johnmitch 37. johnmitch Lv 1 27 pts. 10,918
  8. Avatar for Hellcat6 38. Hellcat6 Lv 1 26 pts. 10,902
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 24 pts. 10,900
  10. Avatar for diamonddays 40. diamonddays Lv 1 23 pts. 10,889

Comments