Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for harvardman 91. harvardman Lv 1 2 pts. 9,661
  2. Avatar for atlas100 92. atlas100 Lv 1 2 pts. 9,645
  3. Avatar for Curiosity_the_cat 93. Curiosity_the_cat Lv 1 2 pts. 9,589
  4. Avatar for fisherlr777 94. fisherlr777 Lv 1 2 pts. 9,582
  5. Avatar for JasperD 95. JasperD Lv 1 2 pts. 9,551
  6. Avatar for SaintNick 96. SaintNick Lv 1 2 pts. 9,531
  7. Avatar for henur 97. henur Lv 1 2 pts. 9,500
  8. Avatar for sydlg19 98. sydlg19 Lv 1 1 pt. 9,427
  9. Avatar for multaq 99. multaq Lv 1 1 pt. 9,415
  10. Avatar for johngran 100. johngran Lv 1 1 pt. 9,361

Comments