Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019
  1. Avatar for harvardman 91. harvardman Lv 1 2 pts. 9,661
  2. Avatar for atlas100 92. atlas100 Lv 1 2 pts. 9,645
  3. Avatar for Curiosity_the_cat 93. Curiosity_the_cat Lv 1 2 pts. 9,589
  4. Avatar for fisherlr777 94. fisherlr777 Lv 1 2 pts. 9,582
  5. Avatar for JasperD 95. JasperD Lv 1 2 pts. 9,551
  6. Avatar for SaintNick 96. SaintNick Lv 1 2 pts. 9,531
  7. Avatar for henur 97. henur Lv 1 2 pts. 9,500
  8. Avatar for sydlg19 98. sydlg19 Lv 1 1 pt. 9,427
  9. Avatar for multaq 99. multaq Lv 1 1 pt. 9,415
  10. Avatar for johngran 100. johngran Lv 1 1 pt. 9,361

Comments