Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for felixxy 101. felixxy Lv 1 1 pt. 9,355
  2. Avatar for doctaven 102. doctaven Lv 1 1 pt. 9,352
  3. Avatar for FrankytheBrain 103. FrankytheBrain Lv 1 1 pt. 9,339
  4. Avatar for rinze 104. rinze Lv 1 1 pt. 9,322
  5. Avatar for Lyshi2018 105. Lyshi2018 Lv 1 1 pt. 9,286
  6. Avatar for alwan2018 106. alwan2018 Lv 1 1 pt. 9,281
  7. Avatar for navn 107. navn Lv 1 1 pt. 9,262
  8. Avatar for jausmh 108. jausmh Lv 1 1 pt. 9,251
  9. Avatar for PlagueRat 109. PlagueRat Lv 1 1 pt. 9,202
  10. Avatar for dbuske 110. dbuske Lv 1 1 pt. 9,200

Comments