Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019
  1. Avatar for felixxy 101. felixxy Lv 1 1 pt. 9,355
  2. Avatar for doctaven 102. doctaven Lv 1 1 pt. 9,352
  3. Avatar for FrankytheBrain 103. FrankytheBrain Lv 1 1 pt. 9,339
  4. Avatar for rinze 104. rinze Lv 1 1 pt. 9,322
  5. Avatar for Lyshi2018 105. Lyshi2018 Lv 1 1 pt. 9,286
  6. Avatar for alwan2018 106. alwan2018 Lv 1 1 pt. 9,281
  7. Avatar for navn 107. navn Lv 1 1 pt. 9,262
  8. Avatar for jausmh 108. jausmh Lv 1 1 pt. 9,251
  9. Avatar for PlagueRat 109. PlagueRat Lv 1 1 pt. 9,202
  10. Avatar for dbuske 110. dbuske Lv 1 1 pt. 9,200

Comments