Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for petetrig 121. petetrig Lv 1 1 pt. 8,355
  2. Avatar for altejoh 122. altejoh Lv 1 1 pt. 8,310
  3. Avatar for psygraphgames 123. psygraphgames Lv 1 1 pt. 8,219
  4. Avatar for uihcv 124. uihcv Lv 1 1 pt. 8,216
  5. Avatar for mcapoor 125. mcapoor Lv 1 1 pt. 8,197
  6. Avatar for ourtown 126. ourtown Lv 1 1 pt. 8,185
  7. Avatar for mbinfield 127. mbinfield Lv 1 1 pt. 7,761
  8. Avatar for CB19TAKA 128. CB19TAKA Lv 1 1 pt. 7,377
  9. Avatar for komnor 129. komnor Lv 1 1 pt. 7,013
  10. Avatar for lconor 130. lconor Lv 1 1 pt. 7,009

Comments