Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019
  1. Avatar for petetrig 121. petetrig Lv 1 1 pt. 8,355
  2. Avatar for altejoh 122. altejoh Lv 1 1 pt. 8,310
  3. Avatar for psygraphgames 123. psygraphgames Lv 1 1 pt. 8,219
  4. Avatar for uihcv 124. uihcv Lv 1 1 pt. 8,216
  5. Avatar for mcapoor 125. mcapoor Lv 1 1 pt. 8,197
  6. Avatar for ourtown 126. ourtown Lv 1 1 pt. 8,185
  7. Avatar for mbinfield 127. mbinfield Lv 1 1 pt. 7,761
  8. Avatar for CB19TAKA 128. CB19TAKA Lv 1 1 pt. 7,377
  9. Avatar for komnor 129. komnor Lv 1 1 pt. 7,013
  10. Avatar for lconor 130. lconor Lv 1 1 pt. 7,009

Comments