Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for Galaxie 11. Galaxie Lv 1 73 pts. 11,178
  2. Avatar for phi16 12. phi16 Lv 1 71 pts. 11,176
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 68 pts. 11,175
  4. Avatar for actiasluna 14. actiasluna Lv 1 66 pts. 11,175
  5. Avatar for robgee 15. robgee Lv 1 64 pts. 11,174
  6. Avatar for reefyrob 16. reefyrob Lv 1 62 pts. 11,156
  7. Avatar for nicobul 17. nicobul Lv 1 60 pts. 11,152
  8. Avatar for crpainter 18. crpainter Lv 1 58 pts. 11,146
  9. Avatar for tyler0911 19. tyler0911 Lv 1 56 pts. 11,109
  10. Avatar for grogar7 20. grogar7 Lv 1 54 pts. 11,088

Comments