Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups


  1. Avatar for Go Science 100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019

  1. Avatar for Galaxie 11. Galaxie Lv 1 73 pts. 11,178
  2. Avatar for phi16 12. phi16 Lv 1 71 pts. 11,176
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 68 pts. 11,175
  4. Avatar for actiasluna 14. actiasluna Lv 1 66 pts. 11,175
  5. Avatar for robgee 15. robgee Lv 1 64 pts. 11,174
  6. Avatar for reefyrob 16. reefyrob Lv 1 62 pts. 11,156
  7. Avatar for nicobul 17. nicobul Lv 1 60 pts. 11,152
  8. Avatar for crpainter 18. crpainter Lv 1 58 pts. 11,146
  9. Avatar for tyler0911 19. tyler0911 Lv 1 56 pts. 11,109
  10. Avatar for grogar7 20. grogar7 Lv 1 54 pts. 11,088

Comments