Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377

  1. Avatar for Vinara 31. Vinara Lv 1 36 pts. 10,974
  2. Avatar for Glen B 32. Glen B Lv 1 35 pts. 10,958
  3. Avatar for WBarme1234 33. WBarme1234 Lv 1 34 pts. 10,941
  4. Avatar for Blipperman 34. Blipperman Lv 1 32 pts. 10,924
  5. Avatar for jobo0502 35. jobo0502 Lv 1 31 pts. 10,916
  6. Avatar for heather-1 36. heather-1 Lv 1 30 pts. 10,868
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 29 pts. 10,866
  8. Avatar for pvc78 38. pvc78 Lv 1 28 pts. 10,863
  9. Avatar for manu8170 39. manu8170 Lv 1 27 pts. 10,854
  10. Avatar for Sissue 40. Sissue Lv 1 25 pts. 10,843

Comments