Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019
  1. Avatar for Vinara 31. Vinara Lv 1 36 pts. 10,974
  2. Avatar for Glen B 32. Glen B Lv 1 35 pts. 10,958
  3. Avatar for WBarme1234 33. WBarme1234 Lv 1 34 pts. 10,941
  4. Avatar for Blipperman 34. Blipperman Lv 1 32 pts. 10,924
  5. Avatar for jobo0502 35. jobo0502 Lv 1 31 pts. 10,916
  6. Avatar for heather-1 36. heather-1 Lv 1 30 pts. 10,868
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 29 pts. 10,866
  8. Avatar for pvc78 38. pvc78 Lv 1 28 pts. 10,863
  9. Avatar for manu8170 39. manu8170 Lv 1 27 pts. 10,854
  10. Avatar for Sissue 40. Sissue Lv 1 25 pts. 10,843

Comments