Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for silent gene 51. silent gene Lv 1 16 pts. 10,584
  2. Avatar for TheGUmmer 52. TheGUmmer Lv 1 15 pts. 10,578
  3. Avatar for johnmitch 53. johnmitch Lv 1 15 pts. 10,572
  4. Avatar for Pibeagles1 54. Pibeagles1 Lv 1 14 pts. 10,551
  5. Avatar for Wojcimierz 55. Wojcimierz Lv 1 13 pts. 10,520
  6. Avatar for diamonddays 56. diamonddays Lv 1 13 pts. 10,498
  7. Avatar for O Seki To 57. O Seki To Lv 1 12 pts. 10,483
  8. Avatar for gdnskye 58. gdnskye Lv 1 12 pts. 10,467
  9. Avatar for aznarog 59. aznarog Lv 1 11 pts. 10,455
  10. Avatar for YeshuaLives 60. YeshuaLives Lv 1 11 pts. 10,444

Comments