Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019
  1. Avatar for silent gene 51. silent gene Lv 1 16 pts. 10,584
  2. Avatar for TheGUmmer 52. TheGUmmer Lv 1 15 pts. 10,578
  3. Avatar for johnmitch 53. johnmitch Lv 1 15 pts. 10,572
  4. Avatar for Pibeagles1 54. Pibeagles1 Lv 1 14 pts. 10,551
  5. Avatar for Wojcimierz 55. Wojcimierz Lv 1 13 pts. 10,520
  6. Avatar for diamonddays 56. diamonddays Lv 1 13 pts. 10,498
  7. Avatar for O Seki To 57. O Seki To Lv 1 12 pts. 10,483
  8. Avatar for gdnskye 58. gdnskye Lv 1 12 pts. 10,467
  9. Avatar for aznarog 59. aznarog Lv 1 11 pts. 10,455
  10. Avatar for YeshuaLives 60. YeshuaLives Lv 1 11 pts. 10,444

Comments