Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for Squirrely 71. Squirrely Lv 1 6 pts. 10,211
  2. Avatar for cbwest 72. cbwest Lv 1 6 pts. 10,207
  3. Avatar for fpc 73. fpc Lv 1 6 pts. 10,200
  4. Avatar for Maerlyn138 74. Maerlyn138 Lv 1 5 pts. 10,187
  5. Avatar for Merf 75. Merf Lv 1 5 pts. 10,133
  6. Avatar for oureion 76. oureion Lv 1 5 pts. 10,126
  7. Avatar for RyeSnake 77. RyeSnake Lv 1 5 pts. 10,121
  8. Avatar for Mike Cassidy 78. Mike Cassidy Lv 1 4 pts. 10,070
  9. Avatar for Crossed Sticks 79. Crossed Sticks Lv 1 4 pts. 10,038
  10. Avatar for carsonfb 80. carsonfb Lv 1 4 pts. 10,031

Comments