Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019
  1. Avatar for Squirrely 71. Squirrely Lv 1 6 pts. 10,211
  2. Avatar for cbwest 72. cbwest Lv 1 6 pts. 10,207
  3. Avatar for fpc 73. fpc Lv 1 6 pts. 10,200
  4. Avatar for Maerlyn138 74. Maerlyn138 Lv 1 5 pts. 10,187
  5. Avatar for Merf 75. Merf Lv 1 5 pts. 10,133
  6. Avatar for oureion 76. oureion Lv 1 5 pts. 10,126
  7. Avatar for RyeSnake 77. RyeSnake Lv 1 5 pts. 10,121
  8. Avatar for Mike Cassidy 78. Mike Cassidy Lv 1 4 pts. 10,070
  9. Avatar for Crossed Sticks 79. Crossed Sticks Lv 1 4 pts. 10,038
  10. Avatar for carsonfb 80. carsonfb Lv 1 4 pts. 10,031

Comments