Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for justjustin 81. justjustin Lv 1 4 pts. 10,025
  2. Avatar for Knoblerine 82. Knoblerine Lv 1 4 pts. 9,997
  3. Avatar for rabamino12358 83. rabamino12358 Lv 1 3 pts. 9,985
  4. Avatar for Arne Heessels 84. Arne Heessels Lv 1 3 pts. 9,960
  5. Avatar for Jesse Pinkman 85. Jesse Pinkman Lv 1 3 pts. 9,940
  6. Avatar for momadoc 86. momadoc Lv 1 3 pts. 9,875
  7. Avatar for abiogenesis 87. abiogenesis Lv 1 3 pts. 9,853
  8. Avatar for rezaefar 88. rezaefar Lv 1 3 pts. 9,768
  9. Avatar for pfirth 89. pfirth Lv 1 2 pts. 9,747
  10. Avatar for hajtogato 90. hajtogato Lv 1 2 pts. 9,729

Comments