Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019
  1. Avatar for justjustin 81. justjustin Lv 1 4 pts. 10,025
  2. Avatar for Knoblerine 82. Knoblerine Lv 1 4 pts. 9,997
  3. Avatar for rabamino12358 83. rabamino12358 Lv 1 3 pts. 9,985
  4. Avatar for Arne Heessels 84. Arne Heessels Lv 1 3 pts. 9,960
  5. Avatar for Jesse Pinkman 85. Jesse Pinkman Lv 1 3 pts. 9,940
  6. Avatar for momadoc 86. momadoc Lv 1 3 pts. 9,875
  7. Avatar for abiogenesis 87. abiogenesis Lv 1 3 pts. 9,853
  8. Avatar for rezaefar 88. rezaefar Lv 1 3 pts. 9,768
  9. Avatar for pfirth 89. pfirth Lv 1 2 pts. 9,747
  10. Avatar for hajtogato 90. hajtogato Lv 1 2 pts. 9,729

Comments